Structure of PDB 5sva Chain X Binding Site BS01

Receptor Information
>5sva Chain X (length=92) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QNPLPTRFEVELEFIQSLANIQYVTYLLTQQQIWKSPNFKNYLKYLEYWC
NPPYSQCIVYPNCLFILKLLNGFMESAIVNEDGLLEGLDELP
Ligand information
>5sva Chain k (length=25) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSYSPTSPSYSPTSPSYSPTSPSYS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5sva Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
Resolution15.3 Å
Binding residue
(original residue number in PDB)		K50 P52 N53 N56 E96 D97
Binding residue
(residue number reindexed from 1)		K35 P37 N38 N41 E81 D82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003712 transcription coregulator activity
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
Biological Process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0006311 meiotic gene conversion
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006366 transcription by RNA polymerase II
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0016592 mediator complex
GO:0070847 core mediator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5sva, PDBe:5sva, PDBj:5sva
PDBsum5sva
PubMed27610567
UniProtP38633|MED31_YEAST Mediator of RNA polymerase II transcription subunit 31 (Gene Name=SOH1)

[Back to BioLiP]