Structure of PDB 5dbe Chain X Binding Site BS01

Receptor Information
>5dbe Chain X (length=306) Species: 71421 (Haemophilus influenzae Rd KW20) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAIYADNSYSIGNTPLVRLKHFGHNGNVVVKIEGRNPSYSVKCRIGANMV
WQAEKDGTLTKGKEIVDATNTGIALAYVAAARGYKITLTMPETMSLERKR
LLCGLGVNLVLTEGAKGMKGAIKAEEIVDPSRYVMLKQFENPANPQIHRE
TTGPEIWKDTDGKVDVVVAGVGTGGSITGISRAIKLDFGKQITSVAVEPV
ESPVISQTLAGEEVKPGPHKIQGIGAGFIPKNLDLSIIDRVETVDSDTAL
ATARRLMAEEGILAGISSGAAVAAADRLAKLPEFADKLIVVILPSASERY
LSTALF
Ligand information
>5dbe Chain A (length=6) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FEYGDG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dbe Crystal Structure Of O-Acetylserine Sulfhydrylase From Haemophilus Influenzae In Complex With Pre-Reactive O-Acetyl Serine, Alpha-Aminoacrylate Reactionintermediate And Peptide Inhibitor At The Resolution Of 2.25A
Resolution2.25 Å
Binding residue
(original residue number in PDB)
G116 A117 K118 G119 M120 K121 P223 H224 K225 A231
Binding residue
(residue number reindexed from 1)
G114 A115 K116 G117 M118 K119 P218 H219 K220 A226
Enzymatic activity
Enzyme Commision number 2.5.1.47: cysteine synthase.
Gene Ontology
Molecular Function
GO:0004124 cysteine synthase activity
GO:0016740 transferase activity
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0080146 L-cysteine desulfhydrase activity
Biological Process
GO:0006535 cysteine biosynthetic process from serine
GO:0019344 cysteine biosynthetic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5dbe, PDBe:5dbe, PDBj:5dbe
PDBsum5dbe
PubMed
UniProtP45040|CYSK_HAEIN Cysteine synthase (Gene Name=cysK)

[Back to BioLiP]