Structure of PDB 3pkm Chain X Binding Site BS01

Receptor Information
>3pkm Chain X (length=233) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHHGSRFLIRLVFKVPYNHQYYLQGLIYNAIKSSNPKLATYLHEVKGPK
LFTYSLFMAEKREHPYFLGYKKGFFYFSTCVPEIAEALVNGLLMNPEVRL
WDERFYLHEIKVLREPKKFNGSTFVTLSPIAVTVVRKGKSYDVPPMEKEF
YSIIKDDLQDKYVMAYGDKPPSEFEMEVLIAKPKRFRIKPGIYQTAWHLV
FRAYGNDDLLKVGYEVGFGEKNSLGFGMVKVEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pkm Interaction of the Cas6 Riboendonuclease with CRISPR RNAs: Recognition and Cleavage.
Resolution3.103 Å
Binding residue
(original residue number in PDB)		R12 Y26 F65 M66 A67 E68 R70 H72 F79 F86 Y153 K194 P195 K196 R197 Y205 T207 H210 V212 E244
Binding residue
(residue number reindexed from 1)		R11 Y18 F57 M58 A59 E60 R62 H64 F67 F74 Y141 K182 P183 K184 R185 Y193 T195 H198 V200 E232
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0016788 hydrolase activity, acting on ester bonds
Biological Process
GO:0043571 maintenance of CRISPR repeat elements
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3pkm, PDBe:3pkm, PDBj:3pkm
PDBsum3pkm
PubMed21300293
UniProtQ8U1S4|CAS6_PYRFU CRISPR-associated endoribonuclease Cas6 (Gene Name=cas6)

[Back to BioLiP]