Structure of PDB 2xd0 Chain X Binding Site BS01

Receptor Information
>2xd0 Chain X (length=162) Species: 29471 (Pectobacterium atrosepticum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKFYTISSKYIEYLKEFDDKVPNSEDPTYQNPKAFIGIVLEIQGHKYLAP
LTSPKKWHNNVKESSLSCFKLHENGVPENQLGLINLKFMIPIIEAEVSLL
DLGNMPNTPYKRMLYKQLQFIRANSDKIASKSDTLRNLVLQGKMQGTCNF
SLLEEKYRDFGK
Ligand information
>2xd0 Chain U (length=36) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auucaggugauuugcuaccuuuaagugcagcuagaa
....<<<<...((((.>>>>......))))......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xd0 A processed noncoding RNA regulates an altruistic bacterial antiviral system.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		D19 K20 V21 P22 N23 K62 F88 K143
Binding residue
(residue number reindexed from 1)		D19 K20 V21 P22 N23 K62 F88 K143
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0042802 identical protein binding
Biological Process
GO:0006276 plasmid maintenance
GO:0045892 negative regulation of DNA-templated transcription
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2xd0, PDBe:2xd0, PDBj:2xd0
PDBsum2xd0
PubMed21240270
UniProtB8X8Z0|TOXN_PECAT Endoribonuclease ToxN (Gene Name=toxN)

[Back to BioLiP]