Structure of PDB 2wss Chain X Binding Site BS01

Receptor Information

>2wss Chain X (length=41) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VQNMMRQKEQEHMINWVEKRVVQSISTIAKCIADLKLLSKK

Ligand information

>2wss Chain Z (length=17) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

REYRTKRQLDRELFKLK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2wss The Structure of the Membrane Extrinsic Region of Bovine ATP Synthase
Resolution	3.2 Å
Binding residue (original residue number in PDB)	M164 K168
Binding residue (residue number reindexed from 1)	M4 K8

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0015078	proton transmembrane transporter activity

	Biological Process
GO:0015986	proton motive force-driven ATP synthesis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2wss, PDBe:2wss, PDBj:2wss
PDBsum	2wss
PubMed	19995987
UniProt	P13619\|AT5F1_BOVIN ATP synthase F(0) complex subunit B1, mitochondrial (Gene Name=ATP5PB)

[Back to BioLiP]