Structure of PDB 2vb2 Chain X Binding Site BS01

Receptor Information

>2vb2 Chain X (length=75) Species: 469008 (Escherichia coli BL21(DE3))

PQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEI
KTGDKVAFNFVQQGNLSLLQDIKVS

Ligand information

• Ligand ID: CU
• InChI: InChI=1S/Cu/q+2
• InChIKey: JPVYNHNXODAKFH-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Cu+2]
  CACTVS 3.341: [Cu++]
• Formula: Cu
• Name: COPPER (II) ION
• DrugBank: DB14552
• PDB chain: 2vb2 Chain X Residue 1089

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2vb2 Cu(I) Recognition Via Cation-Pi and Methionine Interactions in Cusf.
• Resolution: 1.7 Å
• Binding residue (original residue number in PDB): H36 W44 M47 M49
• Binding residue (residue number reindexed from 1): H24 W32 M35 M37
• Annotation score: 3

Gene Ontology

Molecular Function

• GO:0005507 copper ion binding
• GO:0005515 protein binding
• GO:0016530 metallochaperone activity
• GO:0016531 copper chaperone activity
• GO:0046872 metal ion binding
• GO:0046914 transition metal ion binding

Biological Process

• GO:0006878 intracellular copper ion homeostasis
• GO:0009636 response to toxic substance
• GO:0010043 response to zinc ion
• GO:0010272 response to silver ion
• GO:0010273 detoxification of copper ion
• GO:0035434 copper ion transmembrane transport
• GO:0046688 response to copper ion
• GO:0060003 copper ion export
• GO:1902601 silver ion transmembrane transport

Cellular Component

• GO:0030288 outer membrane-bounded periplasmic space
• GO:0042597 periplasmic space

External links

• PDB: RCSB:2vb2, PDBe:2vb2, PDBj:2vb2
• PDBsum: 2vb2
• PubMed: 18157124
• UniProt: P77214|CUSF_ECOLI Cation efflux system protein CusF (Gene Name=cusF)