Structure of PDB 2i5s Chain X Binding Site BS01

Receptor Information
>2i5s Chain X (length=104) Species: 8404 (Lithobates pipiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QDWLTFQKKHITNTRDVDCDNIMSTNLFHCKDKNTFIYSRPEPVKAICKG
IIASKNVLTTSEFYLSDCNVTSRPCKYKLKKSTNKFCVTCENQAPVHFVG
VGSC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2i5s Structural basis for catalysis by onconase.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		E1 K9 H10 N34 T35 E91 V96 H97 F98
Binding residue
(residue number reindexed from 1)		E1 K9 H10 N34 T35 E91 V96 H97 F98
Enzymatic activity
Enzyme Commision number 3.1.27.-
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004519 endonuclease activity
GO:0004540 RNA nuclease activity
Biological Process
GO:0050830 defense response to Gram-positive bacterium

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2i5s, PDBe:2i5s, PDBj:2i5s
PDBsum2i5s
PubMed18001769
UniProtP22069|RNP30_LITPI Protein P-30

[Back to BioLiP]