Structure of PDB 1wm0 Chain X Binding Site BS01

Receptor Information

>1wm0 Chain X (length=272) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IEGRLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVI
YDMNSLMMGEDKIKFKHISKEVAIRIFQGCQFRSVEAVQEITEYAKSIPG
FVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKS
LRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKP
IEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQV
IKKTETDMSLHPLLQEIYKDLY

Ligand information

>1wm0 Chain Y (length=10) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KHKILHRLLQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1wm0 A new class of peroxisome proliferator-activated receptor agonists with a novel binding epitope shows antidiabetic effects
Resolution	2.9 Å
Binding residue (original residue number in PDB)	K301 L311 V315 L318 K319 E471
Binding residue (residue number reindexed from 1)	K96 L106 V110 L113 K114 E266

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1wm0, PDBe:1wm0, PDBj:1wm0
PDBsum	1wm0
PubMed	15258145
UniProt	P37231\|PPARG_HUMAN Peroxisome proliferator-activated receptor gamma (Gene Name=PPARG)

[Back to BioLiP]