Structure of PDB 8y6o Chain W Binding Site BS01

Receptor Information
>8y6o Chain W (length=167) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPL
LTLFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYK
EERAVIKAYRDADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLGGKKES
GQLRFGGRDRPFRKPIN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8y6o Structural basis of U12-type intron engagement by the fully assembled human minor spliceosome
Resolution3.38 Å
Binding residue
(original residue number in PDB)		H27 K148 G151 L153 F155 R163
Binding residue
(residue number reindexed from 1)		H27 K148 G151 L153 F155 R163
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0017069 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005689 U12-type spliceosomal complex
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8y6o, PDBe:8y6o, PDBj:8y6o
PDBsum8y6o
PubMed38484052
UniProtQ16560|U1SBP_HUMAN U11/U12 small nuclear ribonucleoprotein 35 kDa protein (Gene Name=SNRNP35)

[Back to BioLiP]