Structure of PDB 8x1c Chain W Binding Site BS01

Receptor Information
>8x1c Chain W (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQ
FKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHL
LKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYK
HETEFAELEVKTREKLEAAKKKTSFEIAELKERLKAS
Ligand information
>8x1c Chain Y (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctggagaatcccggtgccgaggccgctcaattggtcgtagacagctctag
caccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaagg
ggattactccctagtctccaggcacgtgtcacatatatacatcctgt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8x1c Structure of nucleosome-bound SRCAP-C in the ADP-bound state
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R38 E39 E40 D41
Binding residue
(residue number reindexed from 1)		R21 E22 E23 D24
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005200 structural constituent of cytoskeleton
GO:0005515 protein binding
GO:0042393 histone binding
GO:0070577 lysine-acetylated histone binding
GO:0140030 modification-dependent protein binding
Biological Process
GO:0000278 mitotic cell cycle
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0007010 cytoskeleton organization
GO:0042981 regulation of apoptotic process
GO:0045893 positive regulation of DNA-templated transcription
GO:0051726 regulation of cell cycle
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2000779 regulation of double-strand break repair
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0016363 nuclear matrix
GO:0031965 nuclear membrane
GO:0035267 NuA4 histone acetyltransferase complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8x1c, PDBe:8x1c, PDBj:8x1c
PDBsum8x1c
PubMed38331872
UniProtO95619|YETS4_HUMAN YEATS domain-containing protein 4 (Gene Name=YEATS4)

[Back to BioLiP]