Structure of PDB 8v6v Chain W Binding Site BS01

Receptor Information
>8v6v Chain W (length=449) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMK
HYRNIPGPHMVLVPKSTLHNWMSEFKRWVPTLRSVCLIGDKEQRAAFVRD
VLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEI
VREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFERLH
MVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQREWYTRILMKDIDIL
NSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKM
VVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPH
DERQDSINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQV
DLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQ
Ligand information
>8v6v Chain I (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acaggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctccag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8v6v Functionalized graphene-oxide grids enable high-resolution cryo-EM structures of the SNF2h-nucleosome complex without crosslinking.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		S318 K319 W581 R616 R620
Binding residue
(residue number reindexed from 1)		S145 K146 W396 R431 R435
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0031491 nucleosome binding
GO:0042393 histone binding
GO:0140658 ATP-dependent chromatin remodeler activity
GO:0140751 histone octamer slider activity
Biological Process
GO:0000183 rDNA heterochromatin formation
GO:0006275 regulation of DNA replication
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006338 chromatin remodeling
GO:0006346 DNA methylation-dependent heterochromatin formation
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006974 DNA damage response
GO:0016479 negative regulation of transcription by RNA polymerase I
GO:0031507 heterochromatin formation
GO:0045740 positive regulation of DNA replication
GO:0045893 positive regulation of DNA-templated transcription
GO:0045943 positive regulation of transcription by RNA polymerase I
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0045945 positive regulation of transcription by RNA polymerase III
GO:0140374 antiviral innate immune response
GO:1905213 negative regulation of mitotic chromosome condensation
GO:1990830 cellular response to leukemia inhibitory factor
Cellular Component
GO:0000793 condensed chromosome
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005677 chromatin silencing complex
GO:0005694 chromosome
GO:0005721 pericentric heterochromatin
GO:0005730 nucleolus
GO:0008623 CHRAC
GO:0016589 NURF complex
GO:0016590 ACF complex
GO:0031010 ISWI-type complex
GO:0031213 RSF complex
GO:0035861 site of double-strand break
GO:0043596 nuclear replication fork
GO:0090535 WICH complex
GO:0090536 NoRC complex
GO:0110016 B-WICH complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8v6v, PDBe:8v6v, PDBj:8v6v
PDBsum8v6v
PubMed38472177
UniProtO60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 (Gene Name=SMARCA5)

[Back to BioLiP]