Structure of PDB 8iuh Chain W Binding Site BS01

Receptor Information
>8iuh Chain W (length=111) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
CVVEENDPIFERGSTTTYSSFRKNYYSKPWSNKETDMFFLAISMVGTDFS
MIGQLFPHRARIEIKNKFKREEKTNGWRIDKAFQEKRPFDFDFFAHLLQK
VLAEEEKRKQK
Ligand information
>8iuh Chain X (length=81) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atatgcttaccgtaacttgaaagtatttcgatttcttggctttatatatc
ttgtggaaaggacggtgctcgcttcggcagc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8iuh Structure of the SNAPc-bound RNA polymerase III preinitiation complex.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		R295 S300 N339 R343
Binding residue
(residue number reindexed from 1)		R22 S27 N66 R70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001156 TFIIIC-class transcription factor complex binding
GO:0005515 protein binding
Biological Process
GO:0070898 RNA polymerase III preinitiation complex assembly
Cellular Component
GO:0000126 transcription factor TFIIIB complex
GO:0005634 nucleus
GO:0005654 nucleoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8iuh, PDBe:8iuh, PDBj:8iuh
PDBsum8iuh
PubMed37165065
UniProtA6H8Y1|BDP1_HUMAN Transcription factor TFIIIB component B'' homolog (Gene Name=BDP1)

[Back to BioLiP]