Structure of PDB 8eu9 Chain W Binding Site BS01

Receptor Information
>8eu9 Chain W (length=442) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLIAAHSHITGLGLDENLQPRPTSEGMVGQLQARRAAGVILKMVQNGTIA
GRAVLVAGPPSTGKTALAMGVSQSLGKDVPFTAIAGSEIFSLELSKTEAL
TQAFRKSIGIKIKEETELIEGEVVEIQIDRSITGGHKQGKLTIKTTDMET
IYELGNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGA
DTRFVQCPEGELQKRKTVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRS
EVRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEF
APIVMMATNRGVSKTRGTNYKSPHGLPLDLLDRSIIITTKSYNEQEIKTI
LSIRAQEEEVELSSDALDLLTKTGVETSLRYSSNLISVAQQIAMKRKNNT
VEVEDVKRAYLLFLDSARSVKYVQENESQYIDDQGNVQISIA
Ligand information
>8eu9 Chain Z (length=28) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FVKPRRPYNSEGMTRILRRYEEDLFCTF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eu9 Reorientation of INO80 on hexasomes reveals basis for mechanistic versatility.
Resolution3.48 Å
Binding residue
(original residue number in PDB)		E139 E142 I143 Q144 I145 D146 R147 H153 Q155 K157 E170 K183 A186 F206 R208
Binding residue
(residue number reindexed from 1)		E122 E125 I126 Q127 I128 D129 R130 H136 Q138 K140 E153 K166 A169 F189 R191
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0003678 DNA helicase activity
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0043138 3'-5' DNA helicase activity
GO:0043139 5'-3' DNA helicase activity
Biological Process
GO:0000492 box C/D snoRNP assembly
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006364 rRNA processing
GO:0032508 DNA duplex unwinding
GO:0050821 protein stabilization
Cellular Component
GO:0000785 chromatin
GO:0000812 Swr1 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0031011 Ino80 complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0097255 R2TP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eu9, PDBe:8eu9, PDBj:8eu9
PDBsum8eu9
PubMed37384669
UniProtQ12464|RUVB2_YEAST RuvB-like protein 2 (Gene Name=RVB2)

[Back to BioLiP]