Structure of PDB 8csq Chain W Binding Site BS01

Receptor Information
>8csq Chain W (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRR
PEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8csq Principles of mitoribosomal small subunit assembly in eukaryotes.
Resolution2.54 Å
Binding residue
(original residue number in PDB)		H106 Y113
Binding residue
(residue number reindexed from 1)		H30 Y37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8csq, PDBe:8csq, PDBj:8csq
PDBsum8csq
PubMed36482135
UniProtQ9Y2Q9|RT28_HUMAN Small ribosomal subunit protein bS1m (Gene Name=MRPS28)

[Back to BioLiP]