Structure of PDB 7ywx Chain W Binding Site BS01

Receptor Information

>7ywx Chain W (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLF
VHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG

Ligand information

>7ywx Chain i (length=162) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ccaattccagatactacaaaaagagtgtttcaaaactgctctatgaaaag
gaatgttcaactctatgagttgaatgcaaacatcacatagaagtttctga
gaatgcttctgtctagtttttatgtgaacatattcccgtttccaacgaag
gcctcaaagcgg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7ywx Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
Resolution	12.0 Å
Binding residue (original residue number in PDB)	M1 A2
Binding residue (residue number reindexed from 1)	M1 A2

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0000278	mitotic cell cycle
GO:0007059	chromosome segregation
GO:0034080	CENP-A containing chromatin assembly
GO:0051276	chromosome organization
GO:0051301	cell division
GO:0051382	kinetochore assembly

	Cellular Component
GO:0000775	chromosome, centromeric region
GO:0000776	kinetochore
GO:0000939	inner kinetochore
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005730	nucleolus
GO:0016363	nuclear matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ywx, PDBe:7ywx, PDBj:7ywx
PDBsum	7ywx
PubMed	35420891
UniProt	Q5EE01\|CENPW_HUMAN Centromere protein W (Gene Name=CENPW)

[Back to BioLiP]