Structure of PDB 7qi5 Chain W Binding Site BS01

Receptor Information
>7qi5 Chain W (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKSGGSSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVG
VGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVH
VVPAKPEGTFKLVAML
Ligand information
>7qi5 Chain Ax (length=70) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uagggaauaguuuaaaaaacaucugacucauauucagaagauggagguuc
aauuccuccuucccuaacca
<<<<<<<..<<<<...>>>>.<<<<<.......>>>>>....<<<<<...
....>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qi5 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
Resolution2.63 Å
Binding residue
(original residue number in PDB)		K33 S35
Binding residue
(residue number reindexed from 1)		K1 S3
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qi5, PDBe:7qi5, PDBj:7qi5
PDBsum7qi5
PubMed38769321
UniProtQ9P0M9|RM27_HUMAN Large ribosomal subunit protein bL27m (Gene Name=MRPL27)

[Back to BioLiP]