Structure of PDB 7oqe Chain W Binding Site BS01

Receptor Information
>7oqe Chain W (length=170) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKFTPSIVIDAPQYYVDHFNGKYNVDKCVILRDLQLETDSESMPSSLKHL
TKPTHILDLTNNDLIMIPDLSRRDDIHTLLLGRNNIVEVDGRLLPMNVQN
LTLSNNSIRRFEDLQRLRRAPRTLKNLTLIGNQVCHLANYREHVLRLVPH
LETLDFQNVTAEERKSAMSF
Ligand information
>7oqe Chain 2 (length=143) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guguaguaucuguucuuuucaguguaacaacugaaaugaccucgaggcuc
auacacauuuuuuggcaggacgggaagaggagacgucgcgacccucgcag
agucguucuugacuuggucgcuugauguuucuucuucccguuc
.................<<<<<<......>>>>>><<<<<<<..>>>.>>
>>................<<<<<<<<<<.<<<<<<<<<<<<.<<.....<
<<<<<....>>>>>>>>>>>>..>>>>>>>>.>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oqe Structural insights into how Prp5 proofreads the pre-mRNA branch site.
Resolution5.9 Å
Binding residue
(original residue number in PDB)		N158 A161
Binding residue
(residue number reindexed from 1)		N158 A161
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0030620 U2 snRNA binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0005737 cytoplasm
GO:0071004 U2-type prespliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oqe, PDBe:7oqe, PDBj:7oqe
PDBsum7oqe
PubMed34349264
UniProtQ08963|RU2A_YEAST U2 small nuclear ribonucleoprotein A' (Gene Name=LEA1)

[Back to BioLiP]