Structure of PDB 7o4j Chain W Binding Site BS01

Receptor Information

>7o4j Chain W (length=312) Species: 559292 (Saccharomyces cerevisiae S288C)

DRPIDDIVKNLLKFVVRGFYGGSFVLVLDAILFHSVLAEDDLKQLLSINK
TELGPLIARLRSDRLISIHKQREYPPNSKSVERVYYYVKYPHAIDAIKWK
VHQVVQRLKDDLDKNSEPNGYMCPICLTKYTQLEAVQLLNFDRTEFLCSL
CDEPLVEDDSGKKNKEKQDKLNRLMDQIQPIIDSLKKIDDSRIEENTFEI
ALARLIPPQNQSHAAYTYNPKKGSTMFRPGDSAPATLHINITTASDEVAQ
RELQERQAEEKRKQNAVPEWHKQSTIGKTALGREERENEKTLNDYYAALA
KKQALEDEFEDV

Ligand information

>7o4j Chain N (length=45)

agcacgctgtgtatataatagctatggaacgttcggttgtacata

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7o4j Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
• Resolution: 2.9 Å
• Binding residue (original residue number in PDB): N50 K51 T52
• Binding residue (residue number reindexed from 1): N49 K50 T51

Gene Ontology

Molecular Function

• GO:0000993 RNA polymerase II complex binding
• GO:0001097 TFIIH-class transcription factor complex binding
• GO:0003697 single-stranded DNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0001113 transcription open complex formation at RNA polymerase II promoter
• GO:0006366 transcription by RNA polymerase II
• GO:0006367 transcription initiation at RNA polymerase II promoter

Cellular Component

• GO:0005634 nucleus
• GO:0005673 transcription factor TFIIE complex
• GO:0005739 mitochondrion
• GO:0097550 transcription preinitiation complex

External links

• PDB: RCSB:7o4j, PDBe:7o4j, PDBj:7o4j
• PDBsum: 7o4j
• PubMed: 34133942
• UniProt: P36100|T2EA_YEAST Transcription initiation factor IIE subunit alpha (Gene Name=TFA1)