Structure of PDB 6zku Chain W Binding Site BS01

Receptor Information
>6zku Chain W (length=139) Species: 9940 (Ovis aries) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKRLFIIKPSGFYDKRFLKLLRFYILLTGIPVVIGITLINVFIGEAELAE
IPEGYVPEHWEYFKHPISRWIARTFFDAPEKNYERTMAILQIESEKAELR
LKELEVRRLMRAKGDGPWFQYPTIDKALIDHSPKATPDN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zku The coupling mechanism of mammalian respiratory complex I.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
R111 R112 R115
Binding residue
(residue number reindexed from 1)
R107 R108 R111
External links