Structure of PDB 6z3f Chain W Binding Site BS01

Receptor Information
>6z3f Chain W (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCN
DEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPK
Ligand information
>6z3f Chain P (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CDIHVKWEWDCFEK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6z3f Structural and ITC Characterization of Peptide-Protein Binding: Thermodynamic Consequences of Cyclization Constraints, a Case Study on Vascular Endothelial Growth Factor Ligands.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		F17 Y21 Y25 N62 L66
Binding residue
(residue number reindexed from 1)		F5 Y9 Y13 N50 L54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008083 growth factor activity
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6z3f, PDBe:6z3f, PDBj:6z3f
PDBsum6z3f
PubMed35665969
UniProtP15692|VEGFA_HUMAN Vascular endothelial growth factor A, long form (Gene Name=VEGFA)

[Back to BioLiP]