Structure of PDB 6o8x Chain W Binding Site BS01

Receptor Information
>6o8x Chain W (length=94) Species: 1351 (Enterococcus faecalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLEVKERAIRPRSLRNQLRHEGKVPAIVYGYQIESTPIYFEEKDLSKIL
REHGANTVIKMTVDGKNINTLMSKAQLDTFTGQMLHVEFLSVNM
Ligand information
>6o8x Chain B (length=116) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugugguggcgauagcgagaaggauacaccuguucccaugccgaacacaga
aguuaagcuucuuagcgccgauuguagugaaggguuucccuuugugagag
uaggacgucgccacgc
<<<<<<<<.....<<<<<<<<.....<<<<<<.............>>>>.
.>>....>>>>>>.>>.<<...<...<<<<<<<<...>>>>>>>>....>
..>>...>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o8x Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.
Resolution3.68 Å
Binding residue
(original residue number in PDB)		R10 R13 R15 S16 L17 R18 N19 Q20 R22 H23 I30 Y32 G33 S38 P40 K76 H88 E90 L92
Binding residue
(residue number reindexed from 1)		R8 R11 R13 S14 L15 R16 N17 Q18 R20 H21 I28 Y30 G31 S36 P38 K74 H86 E88 L90
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Apr 5 14:28:57 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6o8x', asym_id = 'W', bs = 'BS01', title = 'Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6o8x', asym_id='W', bs='BS01', title='Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6o8x', asym_id = 'W'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6o8x', asym_id='W')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>