Structure of PDB 5zep Chain W Binding Site BS01

Receptor Information

>5zep Chain W (length=186) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NIPNKLTANVRTRTGKGASRQARRDGKVPAVLYGHGTDPQHLELNARDFA
AVLRSHGTNAILTLDIEGTEQLALTKALDVHPIRRNIQHADLLVVQRGEK
VTVEVTVLVEGDATPGTLVTQDANTIEIEAEALSIPEQLTVSVEGVEAGT
QITAGQISLPEGVNLISDPELLVVNVVEAPSAEALE

Ligand information

>5zep Chain B (length=117) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

guuacggcgguccauagcggcagggaaacgcccggucccaucccgaaccc
ggaagcuaagccugccagcgccgaugauacuacccuuccggguggaaaag
uaggacaccgccgaaca

<<<..<..<..........<........<.<...................
>...>.......>.................<.<......>.>........
.......>..>..>>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5zep Structures of Mycobacterium smegmatis 70S ribosomes in complex with HPF, tmRNA, and P-tRNA.
Resolution	3.4 Å
Binding residue (original residue number in PDB)	R16 T19 G20 K21 G22 S24 R25 R28 R29 V36 Y38 G39 H40 P44 H46 K81 D84 H94
Binding residue (residue number reindexed from 1)	R11 T14 G15 K16 G17 S19 R20 R23 R24 V31 Y33 G34 H35 P39 H41 K76 D79 H89

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5zep, PDBe:5zep, PDBj:5zep
PDBsum	5zep
PubMed	30206241
UniProt	A0R3D2

[Back to BioLiP]