Structure of PDB 5fz5 Chain W Binding Site BS01

Receptor Information
>5fz5 Chain W (length=168) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDIVKNLLKFVVRGFYGGSFVLVLDAILFHSVLAEDDLKQLLSINKTELG
PLIARLRSDRLISIHKQREYPPNSKSVERVYYYVKYPHAIDAIKWKVHQV
VQRLKDGYMCPICLTKYTQLEAVQLLNFDRTEFLCSLCDEPLVEKQDKLN
RLMDQIQPIIDSLKKIDD
Ligand information
>5fz5 Chain T (length=56) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acatcggaggtgaatcgaacgttccatagctattatatacacagcgtgct
actgtt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fz5 Transcription Initiation Complex Structures Elucidate DNA Opening
Resolution8.8 Å
Binding residue
(original residue number in PDB)		N78 S79 K80
Binding residue
(residue number reindexed from 1)		N73 S74 K75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000993 RNA polymerase II complex binding
GO:0001097 TFIIH-class transcription factor complex binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0001113 transcription open complex formation at RNA polymerase II promoter
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
Cellular Component
GO:0005634 nucleus
GO:0005673 transcription factor TFIIE complex
GO:0005739 mitochondrion
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5fz5, PDBe:5fz5, PDBj:5fz5
PDBsum5fz5
PubMed27193681
UniProtP36100|T2EA_YEAST Transcription initiation factor IIE subunit alpha (Gene Name=TFA1)

[Back to BioLiP]