Structure of PDB 4csf Chain W Binding Site BS01

Receptor Information
>4csf Chain W (length=250) Species: 11590 (Toscana virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DENYRDIALAFLDESADSGTINAWVNEFAYQGFDPKRIVQLVKERGTAKG
RDWKKDVKMMIVLNLVRGNKPEAMMKKMSEKGASIVANLISVYQLKEGNP
GRDTITLSRVSAAFVPWTVQALRVLSESLPVSGTTMDAIAGVTYPRAMMH
PSFAGIIDLDLPNGAGATIADAHGLFMIEFSKTINPSLRTKQANEVAATF
EKPNMAAMSGRFFTREDKKKLLIAVGIIDEDLVLASAVVRSAEKYRAKVG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4csf Structural Insights Into RNA Encapsidation and Helical Assembly of the Toscana Virus Nucleoprotein.
Resolution2.598 Å
Binding residue
(original residue number in PDB)		Y32 F35 N71 K72 G100 N101 P102 S110 R111 T185 I186 P188 R191 T201 K204 P205 M207 A208 A209 S211
Binding residue
(residue number reindexed from 1)		Y30 F33 N69 K70 G98 N99 P100 S108 R109 T183 I184 P186 R189 T199 K202 P203 M205 A206 A207 S209
Binding affinityPDBbind-CN: Kd=260nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019013 viral nucleocapsid
GO:0019029 helical viral capsid
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus
GO:0044172 host cell endoplasmic reticulum-Golgi intermediate compartment
GO:0044177 host cell Golgi apparatus
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4csf, PDBe:4csf, PDBj:4csf
PDBsum4csf
PubMed24688060
UniProtP21701|NCAP_TOSV Nucleoprotein (Gene Name=N)

[Back to BioLiP]