Structure of PDB 2m3o Chain W Binding Site BS01

Receptor Information
>2m3o Chain W (length=43) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2m3o Structure and dynamics of human Nedd4-1 WW3 in complex with the alpha ENaC PY motif.
ResolutionN/A
Binding residue
(original residue number in PDB)
R430 F438 I440 H442 T447 W449
Binding residue
(residue number reindexed from 1)
R15 F23 I25 H27 T32 W34
Enzymatic activity
Enzyme Commision number 2.3.2.26: HECT-type E3 ubiquitin transferase.
External links
PDB RCSB:2m3o, PDBe:2m3o, PDBj:2m3o
PDBsum2m3o
PubMed23665454
UniProtP46934|NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 (Gene Name=NEDD4)

[Back to BioLiP]