Structure of PDB 1vpp Chain W Binding Site BS01

Receptor Information
>1vpp Chain W (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVVKFMDVYQRSYCHPIETLVDIFIEYIFKPSCVPLMRCGGCCNDEGLEC
VPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1vpp Crystal structure of the complex between VEGF and a receptor-blocking peptide.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R82 Q89 H90 I91 G92 E93 M94
Binding residue
(residue number reindexed from 1)		R64 Q71 H72 I73 G74 E75 M76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008083 growth factor activity
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1vpp, PDBe:1vpp, PDBj:1vpp
PDBsum1vpp
PubMed9922142
UniProtP15692|VEGFA_HUMAN Vascular endothelial growth factor A, long form (Gene Name=VEGFA)

[Back to BioLiP]