Structure of PDB 1ry1 Chain W Binding Site BS01

Receptor Information
>1ry1 Chain W (length=109) Species: 9615 (Canis lupus familiaris) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKL
MTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYT
KFAQMVKKM
Ligand information
>1ry1 Chain A (length=128) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gacacuaaguucggcaucaauauggugaccucccgggagcgggggaccac
cagguugccuaaggaggggugaaccggcccaggucggaaacggagcaggu
caaaacucccgugcugaucaguaguguc
<<<<<<<.<.<<<<<<<<<<<.<<<<<..<<<<<<....>>>>>>..>>>
>>.>>>>........<<<<<.....<<<<..<.<<<....>>>..>.>>>
>...>>>>>.>>>>>>>.>..>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ry1 Structure of the signal recognition particle interacting with the elongation-arrested ribosome
Resolution12.0 Å
Binding residue
(original residue number in PDB)		T377 D380 S381 N383 R402 R405 R408 G409 S410 G411
Binding residue
(residue number reindexed from 1)		T52 D55 S56 N58 R77 R80 R83 G84 S85 G86
Enzymatic activity
Enzyme Commision number 3.6.5.4: signal-recognition-particle GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ry1, PDBe:1ry1, PDBj:1ry1
PDBsum1ry1
PubMed14985753
UniProtP14576|SRP54_MOUSE Signal recognition particle subunit SRP54 (Gene Name=Srp54)

[Back to BioLiP]