Structure of PDB 1i5h Chain W Binding Site BS01

Receptor Information
>1i5h Chain W (length=50) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSPVDSNDLGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRMQNVAITG
Ligand information
>1i5h Chain B (length=17) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSTLPIPGTPPPNYDSL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1i5h Solution structure of a Nedd4 WW domain-ENaC peptide complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		H470 F476 I478 H480 K483 T485 W487
Binding residue
(residue number reindexed from 1)		H21 F27 I29 H31 K34 T36 W38
Enzymatic activity
Enzyme Commision number 2.3.2.26: HECT-type E3 ubiquitin transferase.
External links
PDB RCSB:1i5h, PDBe:1i5h, PDBj:1i5h
PDBsum1i5h
PubMed11323714
UniProtQ62940|NEDD4_RAT E3 ubiquitin-protein ligase NEDD4 (Gene Name=Nedd4)

[Back to BioLiP]