Structure of PDB 8x15 Chain V Binding Site BS01

Receptor Information
>8x15 Chain V (length=187) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRPEGMHREVYALLYSDKKKVRPWKWMPFTNPARKDGAMFFHWRRAAEEG
KDYPFARFNKTVQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRF
VVIHDRYDHQQFKKRSVEDLKERYYHICAKLANVRAVPGTDLKIPVFDAG
HERRRKEQLERLYNRTPEQVAEEEYLLQELRKIEARK
Ligand information
>8x15 Chain X (length=137) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caggatgtatatatgtgacacgtgcctggagactagggagtaatcccctt
ggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctag
agctgtctacgaccaattgagcggcctcggcaccggg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8x15 Structure of nucleosome-bound SRCAP-C in the apo state
Resolution3.2 Å
Binding residue
(original residue number in PDB)		K48 R49
Binding residue
(residue number reindexed from 1)		K1 R2
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003714 transcription corepressor activity
GO:0005515 protein binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0042307 positive regulation of protein import into nucleus
GO:0042981 regulation of apoptotic process
GO:0045471 response to ethanol
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0051726 regulation of cell cycle
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2000779 regulation of double-strand break repair
Cellular Component
GO:0000786 nucleosome
GO:0000812 Swr1 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005657 replication fork
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0035267 NuA4 histone acetyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8x15, PDBe:8x15, PDBj:8x15
PDBsum8x15
PubMed38331872
UniProtQ9NPF5|DMAP1_HUMAN DNA methyltransferase 1-associated protein 1 (Gene Name=DMAP1)

[Back to BioLiP]