Structure of PDB 8dnt Chain V Binding Site BS01

Receptor Information
>8dnt Chain V (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSN
GDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVREGAQKLVFGQG
TRLTINPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVY
ITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Ligand information
>8dnt Chain X (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LLLDRLNQL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dnt SARS-CoV-2 specific T cell receptor
Resolution3.18 Å
Binding residue
(original residue number in PDB)
Q31 S32 Y51 R92 Q96
Binding residue
(residue number reindexed from 1)
Q28 S29 Y48 R89 Q93
External links