Structure of PDB 7xvm Chain V Binding Site BS01

Receptor Information
>7xvm Chain V (length=84) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRRSASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQI
KLSIRRLLAAGVLKQTKGVGASGSFRLAKSDKAK
Ligand information
>7xvm Chain S (length=169) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcttttttttttcacaatcccggtgccgaggccgctcaattggtcgtaga
cagctctagcaccgcttaaacgcacgtacggaatccgtacgtgcgtttaa
gcggtgctagagctgtctacgaccaattgagcggcctcggcaccgggatt
gtgaaaaaaaaaagctgca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xvm Crystal Structure of Nucleosome-H1.0 Linker Histone Assembly (sticky-169a DNA fragment)
Resolution2.84 Å
Binding residue
(original residue number in PDB)		R48 K70 A90
Binding residue
(residue number reindexed from 1)		R29 K51 A71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0030261 chromosome condensation
GO:0045910 negative regulation of DNA recombination
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xvm, PDBe:7xvm, PDBj:7xvm
PDBsum7xvm
PubMed
UniProtP02259|H5_CHICK Histone H5

[Back to BioLiP]