Structure of PDB 7xn7 Chain V Binding Site BS01

Receptor Information

>7xn7 Chain V (length=106) Species: 460519 (Komagataella phaffii)

RERACMLCGIVLPGRVFMQNGCPNCDSVLNLRDSDQATVNECTSSSFEGL
VAVGDNEHSWVAKWLRVDRFQPGLYAVRVDGRLPSDIVAALEQYGVYYRP
RDGSVI

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 7xn7 Chain V Residue 300

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7xn7 Structural basis of nucleosome disassembly and reassembly by RNAPII elongation complex with FACT.
• Resolution: 3.1 Å
• Binding residue (original residue number in PDB): C12 C15 C29 C32
• Binding residue (residue number reindexed from 1): C5 C8 C22 C25
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0000993 RNA polymerase II complex binding
• GO:0008270 zinc ion binding

Biological Process

• GO:0006325 chromatin organization
• GO:0006355 regulation of DNA-templated transcription
• GO:0006368 transcription elongation by RNA polymerase II
• GO:0034243 regulation of transcription elongation by RNA polymerase II
• GO:0140673 transcription elongation-coupled chromatin remodeling

Cellular Component

• GO:0000775 chromosome, centromeric region
• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0032044 DSIF complex

External links

• PDB: RCSB:7xn7, PDBe:7xn7, PDBj:7xn7
• PDBsum: 7xn7
• PubMed: 35981082
• UniProt: C4R0E6