Structure of PDB 7arb Chain V Binding Site BS01

Receptor Information
>7arb Chain V (length=140) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKVKQTTGIVGLDVVPNARAVLIDLYSKTLKEIQAVPEDEGYRKAVESFT
RQRLNVCKEEEDWEMIEKRLGCGQVEELIEEARDELTLIGKMIEWDPWGV
PDDYECEVIENDAPIPKHVPQHRPGPLPEQFYKTLEGLIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7arb A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
Resolution3.41 Å
Binding residue
(original residue number in PDB)		E116 C117 V119 I120 E121
Binding residue
(residue number reindexed from 1)		E105 C106 V108 I109 E110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0009853 photorespiration
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0009536 plastid
GO:0031966 mitochondrial membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7arb, PDBe:7arb, PDBj:7arb
PDBsum7arb
PubMed33768254
UniProtQ9FLX7|NDUA5_ARATH Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial (Gene Name=At5g52840)

[Back to BioLiP]