Structure of PDB 7ar8 Chain V Binding Site BS01

Receptor Information
>7ar8 Chain V (length=140) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKVKQTTGIVGLDVVPNARAVLIDLYSKTLKEIQAVPEDEGYRKAVESFT
RQRLNVCKEEEDWEMIEKRLGCGQVEELIEEARDELTLIGKMIEWDPWGV
PDDYECEVIENDAPIPKHVPQHRPGPLPEQFYKTLEGLIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ar8 A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
Resolution3.53 Å
Binding residue
(original residue number in PDB)		V111 C117 E118 V119 I120 E121
Binding residue
(residue number reindexed from 1)		V100 C106 E107 V108 I109 E110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0009853 photorespiration
GO:0022904 respiratory electron transport chain
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0009536 plastid
GO:0031966 mitochondrial membrane
GO:0045271 respiratory chain complex I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ar8, PDBe:7ar8, PDBj:7ar8
PDBsum7ar8
PubMed33768254
UniProtQ9FLX7|NDUA5_ARATH Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial (Gene Name=At5g52840)

[Back to BioLiP]