Structure of PDB 7ar7 Chain V Binding Site BS01

Receptor Information
>7ar7 Chain V (length=140) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKVKQTTGIVGLDVVPNARAVLIDLYSKTLKEIQAVPEDEGYRKAVESFT
RQRLNVCKEEEDWEMIEKRLGCGQVEELIEEARDELTLIGKMIEWDPWGV
PDDYECEVIENDAPIPKHVPQHRPGPLPEQFYKTLEGLIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ar7 A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
Resolution3.72 Å
Binding residue
(original residue number in PDB)		D113 Y115 E116 C117 E118 V119 I120 E121 D123
Binding residue
(residue number reindexed from 1)		D102 Y104 E105 C106 E107 V108 I109 E110 D112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0022904 respiratory electron transport chain

View graph for
Biological Process
External links
PDB RCSB:7ar7, PDBe:7ar7, PDBj:7ar7
PDBsum7ar7
PubMed33768254
UniProtQ9FLX7|NDUA5_ARATH Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial (Gene Name=At5g52840)

[Back to BioLiP]