Structure of PDB 6eu0 Chain V Binding Site BS01

Receptor Information
>6eu0 Chain V (length=273) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKVRDGESAKYFIDEENFTMAELCKPNFPIGQISENFEKSKMAKKAKLEK
RRHLRELRMRARQEFKPLHSLTKEEQEEEEEKRKEERDKLESDRKAHTAI
QLKGTMAIDEETMVVDRHKNAENEYKEKVDENPFANLYNYGSYGRGSYTD
PWTVEEMIKFYKALSMWGTDFNLISQLYPYRSRKQVKAKFVNEEKKRPIL
IELALRSKLPPNFDEYCCEIKKNIGTVADFNEKLIELQNEHKHHMKEIEE
AKNTAKEEDQTAQRLNDANLNKK
Ligand information
>6eu0 Chain R (length=51) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ttttcggctactataaaaaaatgtttttttcgttcgcgaagtaacccttc
g
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6eu0 Structural basis of RNA polymerase III transcription initiation.
Resolution4.0 Å
Binding residue
(original residue number in PDB)		P282 S415 T417 K452 Q453 A456
Binding residue
(residue number reindexed from 1)		P26 S147 T149 K184 Q185 A188
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000995 RNA polymerase III general transcription initiation factor activity
GO:0001156 TFIIIC-class transcription factor complex binding
Biological Process
GO:0001112 DNA-templated transcription open complex formation
GO:0006355 regulation of DNA-templated transcription
GO:0006359 regulation of transcription by RNA polymerase III
GO:0006383 transcription by RNA polymerase III
GO:0070898 RNA polymerase III preinitiation complex assembly
Cellular Component
GO:0000126 transcription factor TFIIIB complex
GO:0005634 nucleus
GO:0005654 nucleoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6eu0, PDBe:6eu0, PDBj:6eu0
PDBsum6eu0
PubMed29345637
UniProtP46678|TFC5_YEAST Transcription factor TFIIIB component B'' (Gene Name=BDP1)

[Back to BioLiP]