Structure of PDB 6et5 Chain V Binding Site BS01

Receptor Information
>6et5 Chain V (length=58) Species: 1079 (Blastochloris viridis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATEYRTASWKLWLILDPRRVLTALFVYLTVIALLIHFGLLSTDRLNWWEF
QRGLPKAA
Ligand information
>6et5 Chain U (length=24) Species: 1079 (Blastochloris viridis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SDWNLWVPLGILGIPTIWIALTYR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6et5 Cryo-EM structure of the Blastochloris viridis LH1-RC complex at 2.9 angstrom.
Resolution2.87 Å
Binding residue
(original residue number in PDB)		R5 T6 S8
Binding residue
(residue number reindexed from 1)		R5 T6 S8
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6et5, PDBe:6et5, PDBj:6et5
PDBsum6et5
PubMed29618818
UniProtP04123|LHA_BLAVI Light-harvesting protein B-1015 alpha chain (Gene Name=pufA)

[Back to BioLiP]