Structure of PDB 6bvb Chain V Binding Site BS01

Receptor Information
>6bvb Chain V (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRR
IHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTL
KERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAH
Q
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6bvb HIF-2 alpha-pVHL complex reveals broad genotype-phenotype correlations in HIF-2 alpha-driven disease.
Resolution2.002 Å
Binding residue
(original residue number in PDB)
N67 R69 I75 W88 F91 Y98 P99 G106 H110 S111 Y112 H115 W117
Binding residue
(residue number reindexed from 1)
N9 R11 I17 W30 F33 Y40 P41 G48 H52 S53 Y54 H57 W59
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6bvb, PDBe:6bvb, PDBj:6bvb
PDBsum6bvb
PubMed30135421
UniProtP40337|VHL_HUMAN von Hippel-Lindau disease tumor suppressor (Gene Name=VHL)

[Back to BioLiP]