Structure of PDB 5ui5 Chain V Binding Site BS01

Receptor Information

>5ui5 Chain V (length=323) Species: 224324 (Aquifex aeolicus VF5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ELEELQQNIKLELEGKEQELALELLNYLNEKGFLSKSVEEISDVLRCSVE
ELEKVRQKVLRLEPLGVCSKDVWEFLELQIEEIYPEEEEILKKALRDLKR
GKKLKPEIKGKLSRLRLFPLSAEKVYTFAKVDAIIEEENGEFFIYLYEDF
IDIDLNEEYWELYKKSRNLQKELKEAFERYESIRKVLDIRRRNLRKVLEK
IVERQKDFLTGKGSLKPLTLREVSSEIGIHESTLSRIVNSKYVKTPVGTY
SLRTFFVRESAEGLTQGELMKLIKEIVENEDKRKPYSDQEIANILKEKGF
KVARRTVAKYREMLGIPSSRERR

Ligand information

>5ui5 Chain N (length=31) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gcgaaattggcacgaaaattgcaataaatag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5ui5 Crystal structure of Aquifex aeolicus sigma (N) bound to promoter DNA and the structure of sigma (N)-holoenzyme.
Resolution	3.4 Å
Binding residue (original residue number in PDB)	T293 L294 R295 S309 R327 R332 D362 Q363 R378 R385 R394
Binding residue (residue number reindexed from 1)	T219 L220 R221 S235 R253 R258 D288 Q289 R304 R311 R320
Binding affinity	PDBbind-CN: Kd=103nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0001216	DNA-binding transcription activator activity
GO:0003677	DNA binding
GO:0016987	sigma factor activity

	Biological Process
GO:0006352	DNA-templated transcription initiation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5ui5, PDBe:5ui5, PDBj:5ui5
PDBsum	5ui5
PubMed	28223493
UniProt	O66858

[Back to BioLiP]