Structure of PDB 5jpq Chain V Binding Site BS01

Receptor Information

>5jpq Chain V (length=122) Species: 209285 (Thermochaetoides thermophila)

ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVII
AEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILE
PGEAKDLVDEIIKRVNEIKGKT

Ligand information

>5jpq Chain 3 (length=164)

ccacagaucccacccggguugaugaacgagauccucggcgcacagugagg
uuacucucgcucuaccugcaaagguggcggucgcgugccucgucucgcgg
cuguauagagaguggcgaugaucuguaccccggcggggugggugucgaug
gaagucugaccggc

.............<<<<....<.........<<.<<<....<<.<.....
.<<<<<<.....<<<<......>>>>..<<<<<<<.<......>.>>>>>
>>......>>>>>>.......>..>..<<<<...>>>>....>..>>>..
>>....>..>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5jpq Architecture of the 90S Pre-ribosome: A Structural View on the Birth of the Eukaryotic Ribosome.
• Resolution: 7.3 Å
• Binding residue (original residue number in PDB): K37 G38 V60 Q61 P62 L95 Q96 V97 A98 T99 A100
• Binding residue (residue number reindexed from 1): K31 G32 V54 Q55 P56 L89 Q90 V91 A92 T93 A94

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0004526 ribonuclease P activity
• GO:0019843 rRNA binding

Biological Process

• GO:0001682 tRNA 5'-leader removal
• GO:0006412 translation
• GO:0008033 tRNA processing
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5jpq, PDBe:5jpq, PDBj:5jpq
• PDBsum: 5jpq
• PubMed: 27419870
• UniProt: P55858|RL7A_SACS2 Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)