Structure of PDB 5iy9 Chain V Binding Site BS01

Receptor Information
>5iy9 Chain V (length=475) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLA
EYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCG
AGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFT
SDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEV
HTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANW
MELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRA
CQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQIL
QNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRV
LRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKL
AGMEEEDLAFSTKEEQQQLLQKVLA
Ligand information
>5iy9 Chain X (length=83) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaagggcgcctataaaagggggtgggggcgtttttttttttttttttttt
cgaacactcgagccgagcagacgtgcctacgga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5iy9 Near-atomic resolution visualization of human transcription promoter opening.
Resolution6.3 Å
Binding residue
(original residue number in PDB)		M412 L413 M450 R472 K476
Binding residue
(residue number reindexed from 1)		M169 L170 M207 R229 K233
Enzymatic activity
Enzyme Commision number 5.6.2.4: DNA 3'-5' helicase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0003684 damaged DNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016853 isomerase activity
GO:0016887 ATP hydrolysis activity
GO:0043138 3'-5' DNA helicase activity
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0000717 nucleotide-excision repair, DNA duplex unwinding
GO:0001666 response to hypoxia
GO:0006265 DNA topological change
GO:0006281 DNA repair
GO:0006283 transcription-coupled nucleotide-excision repair
GO:0006289 nucleotide-excision repair
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006368 transcription elongation by RNA polymerase II
GO:0006915 apoptotic process
GO:0006979 response to oxidative stress
GO:0008104 protein localization
GO:0009411 response to UV
GO:0009650 UV protection
GO:0035315 hair cell differentiation
GO:0043065 positive regulation of apoptotic process
GO:0048568 embryonic organ development
GO:1901990 regulation of mitotic cell cycle phase transition
Cellular Component
GO:0000112 nucleotide-excision repair factor 3 complex
GO:0000439 transcription factor TFIIH core complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005669 transcription factor TFIID complex
GO:0005675 transcription factor TFIIH holo complex
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5iy9, PDBe:5iy9, PDBj:5iy9
PDBsum5iy9
PubMed27193682
UniProtP19447|ERCC3_HUMAN General transcription and DNA repair factor IIH helicase/translocase subunit XPB (Gene Name=ERCC3)

[Back to BioLiP]