Structure of PDB 5gm6 Chain V Binding Site BS01

Receptor Information
>5gm6 Chain V (length=128) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKIQQINDKELQSGILSPHQSWHNEYKDNAYIYIGNLNRELTEGDILTVF
SEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRA
LKIDHTFYRPKRSLQKYYEAVKEELDRD
Ligand information
>5gm6 Chain M (length=50) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaaaaaaaaaaaaaaaaacuagauacuaacacauuuaauuuuuuuuuguu
..................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gm6 Structure of a yeast activated spliceosome at 3.5 angstrom resolution
Resolution3.5 Å
Binding residue
(original residue number in PDB)		Y34 Y76 R100 T107 Y109 R110 P111 K112
Binding residue
(residue number reindexed from 1)		Y33 Y75 R99 T106 Y108 R109 P110 K111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000349 generation of catalytic spliceosome for first transesterification step
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0006406 mRNA export from nucleus
GO:0008380 RNA splicing
GO:0051237 maintenance of RNA location
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0005737 cytoplasm
GO:0070274 RES complex
GO:0071011 precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gm6, PDBe:5gm6, PDBj:5gm6
PDBsum5gm6
PubMed27445306
UniProtP40565|IST3_YEAST U2 snRNP component IST3 (Gene Name=IST3)

[Back to BioLiP]