Structure of PDB 4wht Chain V Binding Site BS01

Receptor Information
>4wht Chain V (length=212) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVLTQTTPTLSATIGQSVSISCRSSQSLLESDGNTYLNWLLQRPGQSPQ
LLIYSVSNLESGVPNRFSGSGSETDFTLKISGVEAEDLGVYYCMQTTHAP
TFGAGTKLELKRADAAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISV
KWKIERRDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEVVHK
TSSSPVVKSFNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wht Structural flexibility of a conserved antigenic region in hepatitis C virus glycoprotein e2 recognized by broadly neutralizing antibodies.
Resolution2.22 Å
Binding residue
(original residue number in PDB)
E31 Y37 Y54 T96 T97 H98 A99 P100
Binding residue
(residue number reindexed from 1)
E31 Y37 Y54 T96 T97 H98 A99 P100
External links