Structure of PDB 4qiw Chain V Binding Site BS01

Receptor Information

>4qiw Chain V (length=63) Species: 69014 (Thermococcus kodakarensis KOD1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MIVPVRCFTCGKVLADKYYEFKKRVEAGEDPGKVLDDLGVERYCCRRTLL
SHVELIDQVMVYK

Ligand information

InChI=1S/Zn/q+2

PTFCDOFLOPIGGS-UHFFFAOYSA-N

SMILES

Software	SMILES
CACTVS 3.341	[Zn++]
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Zn+2]

Formula

Zn

Name

ZINC ION

PDB chain

4qiw Chain V Residue 1601 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4qiw The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	T9 C10 C44 C45
Binding residue (residue number reindexed from 1)	T9 C10 C44 C45
Annotation score	1

Enzymatic activity

Enzyme Commision number

2.7.7.6: DNA-directed RNA polymerase.

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003899	DNA-directed 5'-3' RNA polymerase activity
GO:0008270	zinc ion binding
GO:0016779	nucleotidyltransferase activity
GO:0034062	5'-3' RNA polymerase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006351	DNA-templated transcription

	Cellular Component
GO:0000428	DNA-directed RNA polymerase complex
GO:0005694	chromosome
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4qiw, PDBe:4qiw, PDBj:4qiw
PDBsum	4qiw
PubMed	25311937
UniProt	Q5JJC9\|RPO10_THEKO DNA-directed RNA polymerase subunit Rpo10 (Gene Name=rpo10)

[Back to BioLiP]