Structure of PDB 3j47 Chain V Binding Site BS01

Receptor Information
>3j47 Chain V (length=63) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YEEKEESNLAATKSMVKIAEQYSKRIEEEKELTEEELKTRPKKHLSETAD
ETLENNIVSVLTA
Ligand information
>3j47 Chain Q (length=25) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ATYDSALELVGQLNKVVDQLFEKAS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3j47 Formation of an Intricate Helical Bundle Dictates the Assembly of the 26S Proteasome Lid.
Resolution7.4 Å
Binding residue
(original residue number in PDB)		Y251 I255 E258 K259 T262 E265 L266 R269
Binding residue
(residue number reindexed from 1)		Y22 I26 E29 K30 T33 E36 L37 R40
Enzymatic activity
Enzyme Commision number 3.4.19.12: ubiquitinyl hydrolase 1.
External links
PDB RCSB:3j47, PDBe:3j47, PDBj:3j47
PDBsum3j47
PubMed23911091
UniProtP43588|RPN11_YEAST Ubiquitin carboxyl-terminal hydrolase RPN11 (Gene Name=RPN11)

[Back to BioLiP]