Structure of PDB 2wss Chain V Binding Site BS01

Receptor Information
>2wss Chain V (length=66) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKA
DMNTFPNFTFEDPKFE
Ligand information
>2wss Chain U (length=28) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LKSWNETLTSRLVDDFEKKFNYTAQVDA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wss The Structure of the Membrane Extrinsic Region of Bovine ATP Synthase
Resolution3.2 Å
Binding residue
(original residue number in PDB)		N57 T58 F59 D66 P67 F69
Binding residue
(residue number reindexed from 1)		N53 T54 F55 D62 P63 F65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0015078 proton transmembrane transporter activity
Biological Process
GO:0015986 proton motive force-driven ATP synthesis
Cellular Component
GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wss, PDBe:2wss, PDBj:2wss
PDBsum2wss
PubMed19995987
UniProtP02721|ATP5J_BOVIN ATP synthase-coupling factor 6, mitochondrial (Gene Name=ATP5PF)

[Back to BioLiP]