Structure of PDB 1kat Chain V Binding Site BS01

Receptor Information
>1kat Chain V (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC
CNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kat Solution Structure of a Phage-derived Peptide Antagonist in Complex with Vascular Endothelial Growth Factor
ResolutionN/A
Binding residue
(original residue number in PDB)
K48 Q89
Binding residue
(residue number reindexed from 1)
K38 Q79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008083 growth factor activity
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:1kat, PDBe:1kat, PDBj:1kat
PDBsum1kat
PubMed11866530
UniProtP15692|VEGFA_HUMAN Vascular endothelial growth factor A, long form (Gene Name=VEGFA)

[Back to BioLiP]