Structure of PDB 5ydt Chain U5 Binding Site BS01

Receptor Information
>5ydt Chain U5 (length=246) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLAEKALKALILQCEENPSLKNDKDIHIIINTGKKMGINRDNIPRIIPLT
KYKLFKPRDLNILLITKDPSALYRETLTKDEHTSELFKEIISVKNLRRRF
KGSKLTQLYKDFDLVVADYRVHHLLPEVLGSRFYHGSKKLPYMIRMSKEV
KLKRQQMVEKCDPIYVRAQLRSICKNTSYIPNNDNCLSVRVGYIQKHSIP
EILQNIQDTINFLTDKSKRPQGGVIKGGIISIFVKTSNSTSLPIYQ
Ligand information
>5ydt Chain SA (length=52) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gacggagccagcgagccuuggccgagaggucuugguaaaaacuccgucgu
gc
<<<<<<<........<<..<<<<....>>>>..>>......>>>>>>>..
..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ydt Structure and RNA recognition of ribosome assembly factor Utp30.
Resolution4.5 Å
Binding residue
(original residue number in PDB)		H37 N41 R84 R109 S113 L115 Y119 R142 H145 G146 S147 K148 N192 D194 C196 S198 K245 S247 N248 S251
Binding residue
(residue number reindexed from 1)		H27 N31 R74 R99 S103 L105 Y109 R132 H135 G136 S137 K138 N182 D184 C186 S188 K235 S237 N238 S241
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030686 90S preribosome
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5ydt, PDBe:5ydt, PDBj:5ydt
PDBsum5ydt
PubMed28951391
UniProtP36144|RL1D1_YEAST Ribosome biogenesis protein UTP30 (Gene Name=UTP30)

[Back to BioLiP]