Structure of PDB 8yti Chain U Binding Site BS01

Receptor Information
>8yti Chain U (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQ
NGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKK
Ligand information
>8yti Chain T (length=169) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcttttttttttcacaatcccggtgccgaggccgctcaattggtcgtaga
cagctctagcaccgcttaaacgcacgtacggattccgtacgtgcgtttaa
gcggtgctagagctgtctacgaccaattgagcggcctcggcaccgggatt
gtgaaaaaaaaaagctgca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yti Linker Histones Associate Heterogeneously with Nucleosomes in the Condensed State
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R57 N117
Binding residue
(residue number reindexed from 1)		R24 N84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003723 RNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0045296 cadherin binding
Biological Process
GO:0006334 nucleosome assembly
GO:0030261 chromosome condensation
GO:0045910 negative regulation of DNA recombination
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8yti, PDBe:8yti, PDBj:8yti
PDBsum8yti
PubMed
UniProtQ92522|H1X_HUMAN Histone H1.10 (Gene Name=H1-10)

[Back to BioLiP]