Structure of PDB 8i5c Chain U Binding Site BS01

Receptor Information
>8i5c Chain U (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYG
CDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAA
HAAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVP
SGQEQRYTCHVQHEGLPKPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i5c Crystal structure of a TCR in complex with HLA-A*11:01 bound to KRAS peptide (VVGAVGVGK)
Resolution3.34 Å
Binding residue
(original residue number in PDB)
Y7 Y9 E63 D77 T80 Y84 Y99 D116 T143 K146 W147 Q155 Q156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 Y9 E63 D77 T80 Y84 Y99 D116 T143 K146 W147 Q155 Q156 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links